Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC1A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human SLC1A4 (NP_003029.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC1A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human SLC1A4 (NP_003029.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using SLC1A4 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
| Cat.No | ADA-11944A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC1A4 |
| Target Synonyms | SATT; ASCT1; SPATCCM; SLC1A4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human SLC1A4 (NP_003029.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEG | Uniprot ID | P43007 |
Uniprot Id
P43007
Target Species
Human
Target Name
SLC1A4
Target Full Name
Neutral amino acid transporter A
Target Function
Transporter for alanine, serine, cysteine, and threonine. Exhibits sodium dependence.
Target Involvement
Spastic tetraplegia, thin corpus callosum, and progressive microcephaly (SPATCCM)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target Protein Families
Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A4 subfamily
Target Tissue Specificity
Expressed mostly in brain, muscle, and pancreas but detected in all tissues examined.
Target Synonyms
Alanine/serine/cysteine/threonine transporter 1; ASCT-1; ASCT1; AW045657; Glutamate/neutral amino acid transporter; Neutral amino acid transporter A; OTTHUMP00000159933; OTTHUMP00000235138; SATT; SATT_HUMAN; SLC1A4; Solute carrier family 1 (glutamate/neutral amino acid transporter), member 4; Solute carrier family 1 member 4
Target Background
The protein encoded by this gene is a sodium-dependent neutral amino acid transporter for alanine, serine, cysteine, and threonine. Defects in this gene have been associated with developmental delay, microcephaly, and intellectual disability.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
