Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC2A13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 564-648 of human SLC2A13 (NP_443117.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC2A13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 564-648 of human SLC2A13 (NP_443117.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00827A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC2A13 |
| Target Synonyms | HMIT; SLC2A13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HepG2, HT-1080, K-562, Mouse pancreas, NCI-H460, Rat kidney, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 564-648 of human SLC2A13 (NP_443117.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE | Uniprot ID | Q96QE2 |
Uniprot Id
Q96QE2
Target Species
Human
Target Name
SLC2A13
Target Full Name
Proton myo-inositol cotransporter
Target Function
H(+)-myo-inositol cotransporter. Can also transport related stereoisomers.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family
Target Tissue Specificity
Predominantly expressed in the brain.
Target Synonyms
6530403A04; A630029G22Rik; AI505012; Gm308; H(+)-myo-inositol cotransporter; H(+)-myo-inositol symporter; Hmit; MGC48624; MYCT_HUMAN; Proton myo-inositol cotransporter; Slc2a13; Solute carrier family 2 (facilitated glucose transporter), member 13
Target Background
Enables ATPase binding activity; myo-inositol:proton symporter activity; and protease binding activity. Involved in myo-inositol transport and positive regulation of amyloid-beta formation. Is integral component of plasma membrane. Part of cell body; cell periphery; and cell projection.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
