-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC2A8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human SLC2A8 (NP_055395.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC2A8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human SLC2A8 (NP_055395.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00237A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC2A8 |
| Target Synonyms | GLUT8; GLUTX1; SLC2A8 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse brain, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human SLC2A8 (NP_055395.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIG | Uniprot ID | Q9NY64 |
Uniprot Id
Q9NY64
Target Species
Human
Target Name
SLC2A8
Target Full Name
Solute carrier family 2, facilitated glucose transporter member 8
Target Function
Insulin-regulated facilitative hexose transporter that mediates the transport of glucose and fructose. Also able to mediate the transport of dehydroascorbate.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily
Target Tissue Specificity
Highly expressed in testis, but not in testicular carcinoma. Lower amounts present in most other tissues.
Target Synonyms
SLC2A8; GLUT8; GLUTX1; Solute carrier family 2; facilitated glucose transporter member 8; Glucose transporter type 8; GLUT-8; Glucose transporter type X1
Target Background
This gene belongs to the solute carrier 2A family, which includes intracellular glucose transporters. Based on sequence comparison, the glucose transporters are grouped into three classes and this gene is a member of class II. The encoded protein, like other members of the family, contains several conserved residues and motifs and 12 transmembrane domains with both amino and carboxyl ends being on the cytosolic side of the membrane. Alternatively spliced transcript variants have been described for this gene.
Notification