Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC39A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 235-380 of human SLC39A7 (NP_008910.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC39A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 235-380 of human SLC39A7 (NP_008910.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04137A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC39A7 |
| Target Synonyms | KE4; AGM9; HKE4; ZIP7; RING5; H2-KE4; D6S115E; D6S2244E; SLC39A7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, 293T, A-431, LO2, Mouse liver, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 235-380 of human SLC39A7 (NP_008910.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQA | Uniprot ID | Q92504 |
Uniprot Id
Q92504
Target Species
Human
Target Name
SLC39A7
Target Full Name
Zinc transporter SLC39A7
Target Function
Zinc transporter, that transports Zn(2+) from the endoplasmic reticulum/Golgi apparatus to the cytosol. Transport is stimulated by growth factors, such as EGF, and Ca(2+), as well as by exogenous Zn(2+).
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.
Target Protein Families
ZIP transporter (TC 2.A.5) family, KE4/Catsup subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
SLC39A7; HKE4; RING5; Zinc transporter SLC39A7; Histidine-rich membrane protein Ke4; Really interesting new gene 5 protein; Solute carrier family 39 member 7; Zrt-, Irt-like protein 7; ZIP7
Target Background
The protein encoded by this gene transports zinc from the Golgi and endoplasmic reticulum to the cytoplasm. This transport may be important for activation of tyrosine kinases, some of which could be involved in cancer progression. Therefore, modulation of the encoded protein could be useful as a therapeutic agent against cancer. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
