Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC5A12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-280 of human SLC5A12 (NP_848593.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC5A12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-280 of human SLC5A12 (NP_848593.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04585A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC5A12 |
| Target Synonyms | SMCT2; SLC5A12 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-280 of human SLC5A12 (NP_848593.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LIQGSTHAGGFHNVLEQSTNGSRLHIFDFDVDPLRRHTFWTITVGGTFTWLGIYGVNQSTIQRCISCKTEKHAKLALYFNL | Uniprot ID | Q1EHB4 |
Uniprot Id
Q1EHB4
Target Species
Human
Target Name
SLC5A12
Target Full Name
Sodium-coupled monocarboxylate transporter 2
Target Function
Acts as an electroneutral and low-affinity sodium (Na(+))-dependent sodium-coupled solute transporter. Catalyzes the transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, nicotinate, propionate, butyrate and beta-D-hydroxybutyrate. May be responsible for the first step of reabsorption of monocarboxylates from the lumen of the proximal tubule of the kidney and the small intestine. May play also a role in monocarboxylates transport in the retina. Mediates electroneutral uptake of lactate, with a stoichiometry of 2 Na(+) for each lactate.
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Target Synonyms
AI315119; D630015G19; DKFZp564G223; Electroneutral sodium monocarboxylate cotransporter; Low-affinity sodium-lactate cotransporter; MGC52019; RGD1311652; RP24-331J23.1; SC5AC_HUMAN; Slc5a12; SMCT2; Sodium-coupled monocarboxylate transporter 2; Solute carrier family 5 member 12
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
