-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC9A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 542-701 of human SLC9A6 (NP_001036002.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC9A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 542-701 of human SLC9A6 (NP_001036002.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01629A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC9A6 |
| Target Synonyms | MRSA; NHE6; MRXSCH; SLC9A6 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse lung, Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 542-701 of human SLC9A6 (NP_001036002.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VDSDQEHLGVPENERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA | Uniprot ID | Q92581 |
Uniprot Id
Q92581
Target Species
Human
Target Name
SLC9A6
Target Full Name
Sodium/hydrogen exchanger 6
Target Function
Electroneutral exchange of protons for Na(+) and K(+) across the early and recycling endosome membranes. Contributes to calcium homeostasis.
Target Involvement
Mental retardation, X-linked, syndromic, Christianson type (MRXSCH)
Target Subcellular Location
Endosome membrane; Multi-pass membrane protein. Note=Is present in the recycling compartments including early and recycling endosomes, and only appears transiently on the plasma membrane.; [Isoform 2]: Recycling endosome membrane; Multi-pass membrane protein.
Target Protein Families
Monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family
Target Tissue Specificity
Ubiquitous; but is most abundant in mitochondrion-rich tissues such as brain, skeletal muscle and heart.
Target Synonyms
3732426M05; 6430520C02Rik; KIAA0267; mKIAA0267; MRSA; Na(+)/H(+) exchanger 6; NHE-6; NHE6; OTTHUMP00000024089; OTTHUMP00000024090; RGD1563582; RP11-274K13.1; RP23-105E2.4; SL9A6_HUMAN; SLC9A6; Sodium/hydrogen exchanger 6; Solute carrier family 9 (sodium/hydrogen exchanger); isoform 6; Solute carrier family 9 (sodium/hydrogen exchanger); member 6; Solute carrier family 9 member 6; solute carrier family 9; subfamily A (NHE6; cation proton antiporter 6); member 6
Target Background
This gene encodes a sodium-hydrogen exchanger that is amember of the solute carrier family 9. The encoded protein localizes to early and recycling endosomes and may be involved in regulating endosomal pH and volume. Defects in this gene are associated with X-linked syndromic cognitive disability, Christianson type. Alternate splicing results in multiple transcript variants.
Notification