-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Snail was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-267 of human Snail (NP_005976.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Snail was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-267 of human Snail (NP_005976.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12998A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Snail |
| Target Synonyms | SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1; Snail | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, 293F transfected with Snail, HCT 116, K-562 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-267 of human Snail (NP_005976.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR | Uniprot ID | O95863 |
Uniprot Id
O95863
Target Species
Human
Target Name
SNAI1
Target Full Name
Zinc finger protein SNAI1
Target Function
Involved in induction of the epithelial to mesenchymal transition (EMT), formation and maintenance of embryonic mesoderm, growth arrest, survival and cell migration. Binds to 3 E-boxes of the E-cadherin/CDH1 gene promoter and to the promoters of CLDN7 and KRT8 and, in association with histone demethylase KDM1A which it recruits to the promoters, causes a decrease in dimethylated H3K4 levels and represses transcription. The N-terminal SNAG domain competes with histone H3 for the same binding site on the histone demethylase complex formed by KDM1A and RCOR1, and thereby inhibits demethylation of histone H3 at 'Lys-4' (in vitro). During EMT, involved with LOXL2 in negatively regulating pericentromeric heterochromatin transcription. SNAI1 recruits LOXL2 to pericentromeric regions to oxidize histone H3 and repress transcription which leads to release of heterochromatin component CBX5/HP1A, enabling chromatin reorganization and acquisition of mesenchymal traits. Associates with EGR1 and SP1 to mediate tetradecanoyl phorbol acetate (TPA)-induced up-regulation of CDKN2B, possibly by binding to the CDKN2B promoter region 5'-TCACA-3. In addition, may also activate the CDKN2B promoter by itself.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Snail C2H2-type zinc-finger protein family
Target Tissue Specificity
Expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines.
Target Synonyms
dJ710H13.1; Protein sna; Protein snail homolog 1; Protein snail homolog; SLUGH2; SNA; Sna protein; SNAH; SNAI; snai1; SNAI1_HUMAN; Snail 1 homolog; Snail 1 zinc finger protein; SNAIL; Snail family transcriptional repressor 1; Snail homolog 1 (Drosophila); SNAIL, Drosophila, homolog of, 1; SNAIL1; Zinc finger protein SNAI1
Target Background
The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.
Notification