Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SULT1C4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SULT1C4 (NP_006579.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SULT1C4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SULT1C4 (NP_006579.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05065A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SULT1C4 |
| Target Synonyms | SULT1C; SULT1C2; SULT1C4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse lung, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SULT1C4 (NP_006579.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPS | Uniprot ID | O75897 |
Uniprot Id
O75897
Target Species
Human
Target Name
SULT1C4
Target Full Name
Sulfotransferase 1C4
Target Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic compounds. Can also sulfonate estrogenic compounds, however, the dietary flavonoids (phytoestrogen) and environmental estrogens, like bisphenol A are better substrates than 17beta-estradiol (E2). Mediates the sulfation of doxorubicin and its analog epirubicin, two antitumor anthracyclines.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Sulfotransferase 1 family
Target Tissue Specificity
Expressed at high levels in fetal lung and kidney and at low levels in fetal heart, adult kidney, ovary and spinal chord.
Target Synonyms
SULT1C4; SULT1C2; Sulfotransferase 1C4; ST1C4; EC 2.8.2.-; Sulfotransferase 1C2; SULT1C#2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
