-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Tamm Horsfall Glycoprotein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 175-324 of human Tamm Horsfall Glycoprotein. (NP_003352.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Tamm Horsfall Glycoprotein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 175-324 of human Tamm Horsfall Glycoprotein. (NP_003352.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08015A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Tamm Horsfall Glycoprotein |
| Target Synonyms | THP; FJHN; HNFJ; THGP; HNFJ1; MCKD2; ADTKD1; ADMCKD2; Tamm Horsfall Glycoprotein | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 175-324 of human Tamm Horsfall Glycoprotein. (NP_003352.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQ | Uniprot ID | P07911 |
Uniprot Id
P07911
Target Species
Human
Target Name
UMOD
Target Full Name
Uromodulin
Target Function
Functions in biogenesis and organization of the apical membrane of epithelial cells of the thick ascending limb of Henle's loop (TALH), where it promotes formation of complex filamentous gel-like structure that may play a role in the water barrier permeability. May serve as a receptor for binding and endocytosis of cytokines (IL-1, IL-2) and TNF. Facilitates neutrophil migration across renal epithelia.; In the urine, may contribute to colloid osmotic pressure, retards passage of positively charged electrolytes, prevents urinary tract infection and inhibits formation of liquid containing supersaturated salts and subsequent formation of salt crystals.
Target Involvement
Familial juvenile hyperuricemic nephropathy 1 (HNFJ1); Medullary cystic kidney disease 2 (MCKD2); Glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI)
Target Subcellular Location
Apical cell membrane; Lipid-anchor, GPI-anchor. Basolateral cell membrane; Lipid-anchor, GPI-anchor. Cell projection, cilium membrane.; [Uromodulin, secreted form]: Secreted.
Target Tissue Specificity
Expressed in the tubular cells of the kidney. Most abundant protein in normal urine (at protein level). Synthesized exclusively in the kidney. Expressed exclusively by epithelial cells of the thick ascending limb of Henle's loop (TALH) and of distal convo
Target Synonyms
ADMCKD2; FJHN; HNFJ; HNFJ1; MCKD2; medullary cystic kidney disease 2 (autosomal dominant); Tamm Horsfall glycoprotein; Tamm Horsfall urinary glycoprotein; Tamm-Horsfall urinary glycoprotein; THGP; THP; Umod; Urehd1; urehr4; UROM_HUMAN; uromodulin (uromucoid, Tamm-Horsfall glycoprotein); Uromodulin; Uromodulin, secreted form; Uromucoid
Target Background
The protein encoded by this gene is the most abundant protein in mammalian urine under physiological conditions. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. This protein may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of this protein in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the renal disorders medullary cystic kidney disease-2 (MCKD2), glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI), and familial juvenile hyperuricemic nephropathy (FJHN). Alternative splicing of this gene results in multiple transcript variants.
Notification