Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBCCD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 456-557 of human TBCCD1 (NP_060608.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TBCCD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 456-557 of human TBCCD1 (NP_060608.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02874A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBCCD1 |
| Target Synonyms | TBCCD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, Mouse spleen, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 456-557 of human TBCCD1 (NP_060608.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RVFQLLPPCEFYVFIIPFEMEGDTTEIPGGLPSVYQKALGQREQKIQIWQKTVKEAHLTKDQRKQFQVLVENKFYEWLINTGHRQQLDSLVPPAAGSKQAAG | Uniprot ID | Q9NVR7 |
Uniprot Id
Q9NVR7
Target Species
Human
Target Name
TBCCD1
Target Full Name
TBCC domain-containing protein 1
Target Function
Plays a role in the regulation of centrosome and Golgi apparatus positioning, with consequences on cell shape and cell migration.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole. Note=Localizes at the spindle midzone, midbody and basal bodies of primary and motile cilia.
Target Protein Families
TBCC family
Target Synonyms
TBCCD1; TBCC domain-containing protein 1
Target Background
Involved in several processes, including maintenance of Golgi location; maintenance of centrosome location; and regulation of cell shape. Located in spindle pole centrosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
