-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TESC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 135-214 of human TESC (NP_060369.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TESC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 135-214 of human TESC (NP_060369.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01129A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TESC |
| Target Synonyms | TSC; CHP3; TESC | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 135-214 of human TESC (NP_060369.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH | Uniprot ID | Q96BS2 |
Uniprot Id
Q96BS2
Target Species
Human
Target Name
TESC
Target Full Name
Calcineurin B homologous protein 3
Target Function
Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin.
Target Subcellular Location
Nucleus. Cytoplasm. Membrane; Lipid-anchor. Cell membrane. Cell projection, lamellipodium. Cell projection, ruffle membrane.
Target Protein Families
Calcineurin regulatory subunit family, CHP subfamily
Target Tissue Specificity
Expressed in mature megakaryocytes and polymorphonuclear granulocytes (at protein level). Abundantly expressed in heart. Also expressed at a lower level in adult testis and salivary gland, and in the placenta.
Target Research Area
Signal Transduction
Target Synonyms
TESC; CHP3Calcineurin B homologous protein 3; Tescalcin; TSC
Target Background
Enables calcium ion binding activity. Involved in several processes, including cellular response to retinoic acid; positive regulation of macromolecule metabolic process; and positive regulation of myeloid cell differentiation. Located in several cellular components, including cytosol; lamellipodium; and nucleoplasm.
Notification