-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM67 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 780-940 of human TMEM67 (NP_714915.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM67 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 780-940 of human TMEM67 (NP_714915.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00588A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM67 |
| Target Synonyms | MKS3; JBTS6; NPHP11; TNEM67; MECKELIN; TMEM67 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 780-940 of human TMEM67 (NP_714915.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMRQHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYFIKDKLLLERILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLL | Uniprot ID | Q5HYA8 |
Uniprot Id
Q5HYA8
Target Species
Human
Target Name
TMEM67
Target Full Name
Meckelin
Target Function
Required for ciliary structure and function. Part of the tectonic-like complex which is required for tissue-specific ciliogenesis and may regulate ciliary membrane composition. Involved in centrosome migration to the apical cell surface during early ciliogenesis. Involved in the regulation of cilia length and appropriate number through the control of centrosome duplication. Required for cell branching morphology. Essential for endoplasmic reticulum-associated degradation (ERAD) of surfactant protein C (SFTPC).
Target Involvement
Meckel syndrome 3 (MKS3); Joubert syndrome 6 (JBTS6); Bardet-Biedl syndrome (BBS); COACH syndrome (COACHS); Nephronophthisis 11 (NPHP11)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, cilium. Cytoplasm, cytoskeleton, cilium basal body.
Target Tissue Specificity
Widely expressed in adult and fetal tissues. Expressed at higher level in spinal cord.
Target Synonyms
TMEM67; MKS3; Meckelin; Meckel syndrome type 3 protein; Transmembrane protein 67
Target Background
The protein encoded by this gene localizes to the primary cilium and to the plasma membrane. The gene functions in centriole migration to the apical membrane and formation of the primary cilium. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Meckel syndrome type 3 (MKS3) and Joubert syndrome type 6 (JBTS6).
Notification