Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNMD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 92-187 of human TNMD (NP_071427.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TNMD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 92-187 of human TNMD (NP_071427.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11555A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNMD |
| Target Synonyms | TEM; CHM1L; BRICD4; TNMD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, MCF7, Mouse lung, PC-3, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 92-187 of human TNMD (NP_071427.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWIN | Uniprot ID | Q9H2S6 |
Uniprot Id
Q9H2S6
Target Species
Human
Target Name
TNMD
Target Full Name
Tenomodulin
Target Function
May be an angiogenesis inhibitor.
Target Subcellular Location
[Isoform 1]: Membrane; Single-pass type II membrane protein. Nucleus envelope.; [Isoform 2]: Membrane; Single-pass type II membrane protein. Nucleus envelope.; [Isoform 3]: Cytoplasm.
Target Protein Families
Chondromodulin-1 family
Target Tissue Specificity
Highly expressed in hypovascular connective tissues such as tendons. Has also strong expression in adipose tissue.
Target Synonyms
BRICD4; BRICHOS domain containing 4; CHM1 LIKE; ChM1L; Chondromodulin I like; Chondromodulin I like protein; Chondromodulin-1-like protein; Chondromodulin-I-like protein; hChM1L; hTeM; Myodulin; TeM; Tendin; Tenomodulin; Tenomodulin protein; Tnmd; TNMD_HUMAN; UNQ771/PRO1565
Target Background
This gene encodes a protein that is related to chondromodulin-I, which is a cartilage-specific glycoprotein that functions to stimulate chondrocyte growth and to inhibit tube formation of endothelial cells. This protein is also an angiogenesis inhibitor. Genetic variation in this gene is associated with a risk for type 2 diabetes, central obesity and serum levels of systemic immune mediators in a body size-dependent manner. This gene is also a candidate gene for age-related macular degeneration, though a direct link has yet to be demonstrated.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
