-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRAC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-176 of human TRAC (AAH20840.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRAC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-176 of human TRAC (AAH20840.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07969A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRAC |
| Target Synonyms | IMD7; TCRA; TRA@; TRAC | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-176 of human TRAC (AAH20840.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AIELVPEHQTVPVSIGVPATLRCSMKGEAIGNYYINWYRKTQDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNL | Uniprot ID | P01848 |
Uniprot Id
P01848
Target Species
Human
Target Name
TRAC
Target Full Name
T cell receptor alpha chain constant
Target Function
Constant region of T cell receptor (TR) alpha chain. Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-major histocompatibility (MH) (pMH) complexes that are displayed by antigen presenting cells (APC), a prerequisite for efficient T cell adaptive immunity against pathogens. Binding of alpha-beta TR to pMH complex initiates TR-CD3 clustering on the cell surface and intracellular activation of LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E and CD247 enabling the recruitment of ZAP70. In turn, ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor NF-kappa-B (NF-kB) pathways, leading to the mobilization of transcription factors that are critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire is generated in the thymus, by V-(D)-J rearrangement. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MH restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TR with the pMH complexes shapes TR structural and functional avidity.
Target Involvement
Immunodeficiency 7 (IMD7)
Target Subcellular Location
Cell membrane.
Target Research Area
Immunology
Target Synonyms
TRAC; TCRA; T cell receptor alpha constant
Target Background
Enables signaling receptor activity. Involved in T cell mediated cytotoxicity directed against tumor cell target and detection of tumor cell. Part of alpha-beta T cell receptor complex.
Notification