-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIP13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human TRIP13 (NP_004228.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIP13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human TRIP13 (NP_004228.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06711A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIP13 |
| Target Synonyms | MVA3; OOMD9; 16E1BP; OZEMA9; TRIP13 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human TRIP13 (NP_004228.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENII | Uniprot ID | Q15645 |
Uniprot Id
Q15645
Target Species
Human
Target Name
TRIP13
Target Full Name
Pachytene checkpoint protein 2 homolog
Target Function
Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways. Also required for development of higher-order chromosome structures and is needed for synaptonemal-complex formation. In males, required for efficient synapsis of the sex chromosomes and for sex body formation. Promotes early steps of the DNA double-strand breaks (DSBs) repair process upstream of the assembly of RAD51 complexes. Required for depletion of HORMAD1 and HORMAD2 from synapsed chromosomes. Plays a role in mitotic spindle assembly checkpoint (SAC) activation.
Target Involvement
Mosaic variegated aneuploidy syndrome 3 (MVA3)
Target Protein Families
AAA ATPase family, PCH2 subfamily
Target Synonyms
16E1-BP; 16E1BP; Homo sapiens HPV16 E1 protein binding protein mRNA complete cds; HPV16 E1 protein binding protein; HPV16 E1 protein-binding protein; Human papillomavirus type 16 E1 protein binding protein; Human papillomavirus type 16 E1 protein-binding protein; Pachytene checkpoint protein 2 homolog; PCH2; Thyroid hormone receptor interactor 13; Thyroid receptor interacting protein 13; Thyroid receptor-interacting protein 13; TR-interacting protein 13; TRIP-13; Trip13; TRP13_HUMAN
Target Background
This gene encodes a protein that interacts with thyroid hormone receptors, also known as hormone-dependent transcription factors. The gene product interacts specifically with the ligand binding domain. This gene is one of several that may play a role in early-stage non-small cell lung cancer.
Notification