-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UGT2B15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human UGT2B15 (NP_001067.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against UGT2B15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human UGT2B15 (NP_001067.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00148A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UGT2B15 |
| Target Synonyms | HLUG4; UGT2B8; UDPGTH3; UDPGT 2B8; UDPGT2B15; UGT2B15 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, HepG2, HT-29, LO2, MCF7, Mouse liver, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human UGT2B15 (NP_001067.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLF | Uniprot ID | P54855 |
Uniprot Id
P54855
Target Species
Human
Target Name
UGT2B15
Target Full Name
UDP-glucuronosyltransferase 2B15
Target Function
UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (testosterone, androsterone) and estrogens (estradiol, epiestradiol, estriol, catechol estrogens). Displays glucuronidation activity toward several classes of xenobiotic substrates, including phenolic compounds (eugenol, 4-nitrophenol, 4-hydroxybiphenyl) and phenylpropanoids (naringenin, coumarins). Catalyzes the glucuronidation of monoterpenoid alcohols such as borneol, menthol and isomenthol, a class of natural compounds used in essential oils
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
UDP-glycosyltransferase family
Target Tissue Specificity
Expressed in many tissues. Present in liver, prostate and testis.
Target Synonyms
EC 2.4.1.17; HLUG4; UDB15_HUMAN; UDP glucuronosyltransferase 2 family polypeptide B15; UDP glucuronosyltransferase 2 family; member B15; UDP glucuronosyltransferase 2 family; member B8; UDP glucuronosyltransferase 2B15; UDP glucuronosyltransferase UGT2B15; UDP glucuronyltransferase family 2 beta 15; UDP glycosyltransferase 2 family; member B15; UDP glycosyltransferase 2B15; UDP-glucuronosyltransferase 2B15; UDP-glucuronosyltransferase 2B8; UDPGT 2B15; UDPGT 2B8; UDPGT2B15; UDPGTh 3; UDPGTh-3; UDPGTH3; UGT2B15; UGT2B8; Uridine diphosphate glucuronosyltransferase 2 family; member B8; Uridine diphosphate glycosyltransferase 2 family; member B15
Notification