-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ULK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human ULK1 (NP_003556.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ULK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human ULK1 (NP_003556.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12955A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ULK1 |
| Target Synonyms | ATG1; ATG1A; UNC51; hATG1; Unc51.1; ULK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, HepG2, Mouse thymus, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ULK1 (NP_003556.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQS | Uniprot ID | O75385 |
Uniprot Id
O75385
Target Species
Human
Target Name
ULK1
Target Full Name
Serine/threonine-protein kinase ULK1
Target Function
Serine/threonine-protein kinase involved in autophagy in response to starvation. Acts upstream of phosphatidylinositol 3-kinase PIK3C3 to regulate the formation of autophagophores, the precursors of autophagosomes. Part of regulatory feedback loops in autophagy: acts both as a downstream effector and negative regulator of mammalian target of rapamycin complex 1 (mTORC1) via interaction with RPTOR. Activated via phosphorylation by AMPK and also acts as a regulator of AMPK by mediating phosphorylation of AMPK subunits PRKAA1, PRKAB2 and PRKAG1, leading to negatively regulate AMPK activity. May phosphorylate ATG13/KIAA0652 and RPTOR; however such data need additional evidences. Plays a role early in neuronal differentiation and is required for granule cell axon formation. May also phosphorylate SESN2 and SQSTM1 to regulate autophagy. Phosphorylates FLCN, promoting autophagy. Phosphorylates AMBRA1 in response to autophagy induction, releasing AMBRA1 from the cytoskeletal docking site to induce autophagosome nucleation.
Target Subcellular Location
Cytoplasm, cytosol. Preautophagosomal structure.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, APG1/unc-51/ULK1 subfamily
Target Tissue Specificity
Ubiquitously expressed. Detected in the following adult tissues: skeletal muscle, heart, pancreas, brain, placenta, liver, kidney, and lung.
Target Synonyms
ATG 1; ATG1; ATG1 autophagy related 1 homolog; ATG1A; Autophagy related protein 1 homolog; Autophagy-related protein 1 homolog; FLJ38455; FLJ46475; hATG1; KIAA0722; Serine/threonine protein kinase ULK1; Serine/threonine protein kinase Unc51.1; Serine/threonine-protein kinase ULK1; ULK 1; ULK1; ULK1_HUMAN; Unc 51 (C. elegans) like kinase 1; UNC 51; Unc 51 like kinase 1; Unc-51 like kinase 1 (C. elegans); Unc-51-like kinase 1; UNC51; UNC51; C. elegans; homolog of; Unc51.1
Target Background
Enables identical protein binding activity; protein serine/threonine kinase activity; and small GTPase binding activity. Involved in several processes, including autophagosome assembly; positive regulation by symbiont of host autophagy; and protein phosphorylation. Located in autophagosome; cytosol; and phagophore assembly site membrane. Is extrinsic component of autophagosome membrane; extrinsic component of omegasome membrane; and extrinsic component of phagophore assembly site membrane. Part of Atg1/ULK1 kinase complex.
Notification