-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WNT9A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human WNT9A (NP_003386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WNT9A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human WNT9A (NP_003386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00040A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WNT9A |
| Target Synonyms | WNT14; WNT9A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human WNT9A (NP_003386.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVE | Uniprot ID | O14904 |
Uniprot Id
O14904
Target Species
Human
Target Name
WNT9A
Target Full Name
Protein Wnt-9a
Target Function
Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt/beta-catenin signaling pathway. Required for normal timing of IHH expression during embryonic bone development, normal chondrocyte maturation and for normal bone mineralization during embryonic bone development. Plays a redundant role in maintaining joint integrity.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted.
Target Protein Families
Wnt family
Target Synonyms
MGC138165; MGC141991; Protein Wnt-14; Protein Wnt-9a; RP23-378H5.1; Wingless related MMTV integration site 9A; Wingless type MMTV integration site 9A; Wingless type MMTV integration site family, member 9A; wingless-type MMTV integration site family, member 14; Wnt 14; Wnt 9a; WNT14; WNT9A; WNT9A_HUMAN
Target Background
The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is expressed in gastric cancer cell lines. The protein encoded by this gene shows 75% amino acid identity to chicken Wnt14, which has been shown to play a central role in initiating synovial joint formation in the chick limb. This gene is clustered with another family member, WNT3A, in the chromosome 1q42 region.
Notification