-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZDHHC8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human ZDHHC8 (NP_037505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZDHHC8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human ZDHHC8 (NP_037505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01330A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZDHHC8 |
| Target Synonyms | DHHC8; ZNF378; ZDHHCL1; ZDHHC8 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, K562, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human ZDHHC8 (NP_037505.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VEHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAPLKVKLSDNGLKAGLGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPAFPTGPKVPFCGPGEQVPGPD | Uniprot ID | Q9ULC8 |
Uniprot Id
Q9ULC8
Target Species
Human
Target Name
ZDHHC8
Target Full Name
Palmitoyltransferase ZDHHC8
Target Function
Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates and therefore functions in several unrelated biological processes. Through the palmitoylation of ABCA1 regulates the localization of the transporter to the plasma membrane and thereby regulates its function in cholesterol and phospholipid efflux. Could also pamitoylate the D(2) dopamine receptor DRD2 and regulate its stability and localization to the plasma membrane. Could also play a role in glutamatergic transmission.
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
ZDHHC8; KIAA1292; ZDHHCL1; ZNF378; Palmitoyltransferase ZDHHC8; Zinc finger DHHC domain-containing protein 8; DHHC-8; Zinc finger protein 378
Target Background
This gene encodes a four transmembrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein may function as a palmitoyltransferase. Defects in this gene may be associated with a susceptibility to schizophrenia. Alternate splicing of this gene results in multiple transcript variants. A pseudogene of this gene is found on chromosome 22.
Notification