Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF471 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human ZNF471 (NP_065864.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF471 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human ZNF471 (NP_065864.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00207A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF471 |
| Target Synonyms | ERP1; Z1971; Zfp78; ZNF471 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse pancreas, Mouse skeletal muscle, Rat pancreas, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human ZNF471 (NP_065864.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRSPFSDWESIYVTQELPLKQFMYDDACMEGITSYGLECSTFEENWKWEDLFEKQMGSHEMFSKKEIITHKETITKETEFKYTKFGKCIHLENIEESIYNHTSDKKSFSKNSMVIKHKKVYVGKKLFKCNE | Uniprot ID | Q9BX82 |
Uniprot Id
Q9BX82
Target Species
Human
Target Name
ZNF471
Target Full Name
Zinc finger protein 471
Target Function
May be involved in transcriptional regulation.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Synonyms
MGC150658; ERP1; EZFIT related protein 1; EZFIT-related protein 1; KIAA1396; MGC150657; Z1971; Zinc finger protein 471; ZN471_HUMAN; ZNF471
Target Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
