Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF70 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZNF70 (NP_068735.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF70 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZNF70 (NP_068735.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04654A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF70 |
| Target Synonyms | Cos17; ZNF70 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse eye, Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZNF70 (NP_068735.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPY | Uniprot ID | Q9UC06 |
Uniprot Id
Q9UC06
Target Species
Human
Target Name
ZNF70
Target Full Name
Zinc finger protein 70
Target Function
May be involved in transcriptional regulation.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Synonyms
ZNF70; Zinc finger protein 70; Zinc finger protein N27C7-1
Target Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
