Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MLKL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-62 of mouse MLKL (Q9D2Y4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MLKL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-62 of mouse MLKL (Q9D2Y4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12192A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MLKL |
| Target Synonyms | 9130019I15Rik; MLKL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse liver, NCI-H460, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-62 of mouse MLKL (Q9D2Y4). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALG | Uniprot ID | Q9D2Y4 |
Uniprot Id
Q9D2Y4
Target Synonyms
9130019I15Rik; Phospho-MLKL-S441
Target Background
This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to lack protein kinase activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (Rip3), which is a key signaling molecule in necroptosis pathway. Knockout of this gene in mice showed that it is essential for necroptosis. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
