-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GTF2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-154 of GTF2B (NP_001505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GTF2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-154 of GTF2B (NP_001505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11338A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GTF2B |
| Target Synonyms | TF2B; TFIIB; GTF2B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse thymus, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-154 of GTF2B (NP_001505.1). | Immunogen Sequence | VVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGR |
|---|---|---|---|
| Uniprot ID | Q00403 |
Uniprot Id
Q00403
Target Species
Human
Target Name
GTF2B
Target Full Name
Transcription initiation factor IIB
Target Function
General transcription factor that plays a role in transcription initiation by RNA polymerase II (Pol II). Involved in the pre-initiation complex (PIC) formation and Pol II recruitment at promoter DNA. Together with the TATA box-bound TBP forms the core initiation complex and provides a bridge between TBP and the Pol II-TFIIF complex. Released from the PIC early following the onset of transcription during the initiation and elongation transition and reassociates with TBP during the next transcription cycle. Associates with chromatin to core promoter-specific regions. Binds to two distinct DNA core promoter consensus sequence elements in a TBP-independent manner; these IIB-recognition elements (BREs) are localized immediately upstream (BREu), 5'-[GC][GC][GA]CGCC-3', and downstream (BREd), 5'-[GA]T[TGA][TG][GT][TG][TG]-3', of the TATA box element. Modulates transcription start site selection. Exhibits also autoacetyltransferase activity that contributes to the activated transcription.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
TFIIB family
Target Tissue Specificity
Expressed in the inner cell mass forming the embryoblast. Not detected in cells from the outer thin layer trophoblast (at protein level).
Target Research Area
Immunology
Target Synonyms
General transcription factor IIB; General transcription factor TFIIB; gtf2b; RNA polymerase II transcription factor IIB; S300 II; S300-II; TF IIB; TF2B; TF2B_HUMAN; TFIIB; Transcription initiation factor IIB
Target Background
This gene encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II.
Notification