-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF384 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ZNF384 (NP_001129206.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ZNF384 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ZNF384 (NP_001129206.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11356A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF384 |
| Target Synonyms | NP; CIZ; NMP4; CAGH1; ERDA2; TNRC1; CAGH1A; ZNF384 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ZNF384 (NP_001129206.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHS | Uniprot ID | Q8TF68 |
Uniprot Id
Q8TF68
Target Species
Human
Target Name
ZNF384
Target Full Name
Zinc finger protein 384
Target Function
Transcription factor that binds the consensus DNA sequence [GC]AAAAA. Seems to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CAG repeat protein 1; CAGH1A; CAS interacting zinc finger protein; CAS-interacting zinc finger protein; CIZ; ERDA2; GH1A; NMP4; NP; Nuclear matrix protein 4; Nuclear matrix transcription factor 4; TNRC1; Trinucleotide repeat containing gene 1 protei; Trinucleotide repeat-containing gene 1 protein; Zinc finger protein 384; ZN384_HUMAN; Znf384
Target Background
This gene encodes a C2H2-type zinc finger protein, which may function as a transcription factor. This gene also contains long CAG trinucleotide repeats that encode consecutive glutamine residues. The protein appears to bind and regulate the promoters of the extracellular matrix genes MMP1, MMP3, MMP7 and COL1A1. Studies in mouse suggest that nuclear matrix transcription factors (NP/NMP4) may be part of a general mechanical pathway that couples cell construction and function during extracellular matrix remodeling. Alternative splicing results in multiple transcript variants. Recurrent rearrangements of this gene with the Ewing's sarcoma gene, EWSR1 on chromosome 22, or with the TAF15 gene on chromosome 17, or with the TCF3 (E2A) gene on chromosome 19, have been observed in acute leukemia. A related pseudogene has been identified on chromosome 7.
Notification