-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WNT2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNT2 (NP_003382.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against WNT2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNT2 (NP_003382.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11463A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WNT2 |
| Target Synonyms | IRP; INT1L1; WNT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNT2 (NP_003382.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRV | Uniprot ID | P09544 |
Uniprot Id
P09544
Target Species
Human
Target Name
WNT2
Target Full Name
Protein Wnt-2
Target Function
Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family. Functions as upstream regulator of FGF10 expression. Plays an important role in embryonic lung development. May contribute to embryonic brain development by regulating the proliferation of dopaminergic precursors and neurons.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted.
Target Protein Families
Wnt family
Target Tissue Specificity
Expressed in brain in the thalamus, in fetal and adult lung and in placenta.
Target Research Area
Cancer, Stem Cells
Target Synonyms
Int 1 related protein; Int-1-like protein 1; Int-1-related protein; INT1L 1; INT1L1; IRP; IRP protein; ONCOGENE INT1 LIKE 1; Protein Wnt-2; Secreted growth factor; Wingless type MMTV integration site family member 2; WNT 2; WNT2; WNT2_HUMAN
Target Background
This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Alternatively spliced transcript variants have been identified for this gene.
Notification