Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FUT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 186-331 of human FUT4 (NP_002024.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against FUT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 186-331 of human FUT4 (NP_002024.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11532A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FUT4 |
| Target Synonyms | LeX; CD15; ELFT; FCT3A; FUTIV; SSEA-1; FUC-TIV; FUT4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 186-331 of human FUT4 (NP_002024.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYG | Uniprot ID | P22083 |
Uniprot Id
P22083
Target Species
Human
Target Name
FUT4
Target Full Name
Alpha-(1,3)-fucosyltransferase 4
Target Function
May catalyze alpha-1,3 glycosidic linkages involved in the expression of Lewis X/SSEA-1 and VIM-2 antigens.
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Membrane-bound form in trans cisternae of Golgi.
Target Protein Families
Glycosyltransferase 10 family
Target Synonyms
3)-fucosyltransferase; Alpha-(1; Alpha-(1,3)-fucosyltransferase; Alpha-3-fucosyltransferase; ELAM-1 ligand fucosyltransferase; ELFT; FCT3A; Fuc-TIV; Fucosyltransferase 4 (Alpha (1,3) Fucosyltransferase, Myeloid-Specific; Fucosyltransferase 4; Fucosyltransferase IV; FucT-IV; Fut4; FUT4_HUMAN; FUTIV; Galactoside 3-L-fucosyltransferase; Lewis X; LeX; SSEA-1; Stage-Specific Embryonic Antigen 1
Target Background
The product of this gene transfers fucose to N-acetyllactosamine polysaccharides to generate fucosylated carbohydrate structures. It catalyzes the synthesis of the non-sialylated antigen, Lewis x (CD15).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
