Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LSM14A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LSM14A (NP_001107565.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LSM14A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LSM14A (NP_001107565.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11535A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LSM14A |
| Target Synonyms | RAP55; FAM61A; RAP55A; C19orf13; LSM14A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LSM14A (NP_001107565.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGS | Uniprot ID | Q8ND56 |
Uniprot Id
Q8ND56
Target Species
Human
Target Name
LSM14A
Target Full Name
Protein LSM14 homolog A
Target Function
Essential for formation of P-bodies, cytoplasmic structures that provide storage sites for translationally inactive mRNAs and protect them from degradation. Acts as a repressor of mRNA translation. May play a role in mitotic spindle assembly.
Target Subcellular Location
Cytoplasm, P-body. Cytoplasm, cytoskeleton, spindle. Cytoplasm, Stress granule.
Target Protein Families
LSM14 family
Target Synonyms
AlphaSNBP; C19orf13 ; Chromosome 19 open reading frame 13 ; DKFZp434D1335; FAM61A; Family with sequence similarity 61 member A; hRAP55; hRAP55A; LS14A_HUMAN; LSM14 homolog A (SCD6 S cerevisiae); LSM14 homolog A; LSM14A; Protein FAM61A; Protein LSM14 homolog A; Protein SCD6 homolog; Putative alpha synuclein binding protein ; Putative alpha-synuclein-binding protein; RAP55; RNA associated protein 55 ; RNA-associated protein 55A; SCD6 homolog A (S cerevisiae)
Target Background
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
