Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CFAP44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-370 of human CFAP44 (NP_001157968.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CFAP44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-370 of human CFAP44 (NP_001157968.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11680A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CFAP44 |
| Target Synonyms | WDR52; SPGF20; CFAP44 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, OVCAR3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-370 of human CFAP44 (NP_001157968.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSSGEGIGVIGVHPHKTYFTVAEKGSFPDIIIYEYPSLRPYRVLRDGTEKGYAYVDFNYSGNLLASVGSNPDYTLTIWNWKEEQPILRTKAFSQEVFKVTFNPDKEEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTITTDIEGYMELPDGKVLSGSEWGNMLLWEGGLIKVELCRGTSKSCHNGPI | Uniprot ID | Q96MT7 |
Uniprot Id
Q96MT7
Target Species
Human
Target Name
CFAP44
Target Full Name
Cilia- and flagella-associated protein 44
Target Function
Flagellar protein involved in sperm flagellum axoneme organization and function.
Target Subcellular Location
Cell projection, cilium, flagellum. Cytoplasm, cytoskeleton, flagellum axoneme.
Target Protein Families
CFAP44 family
Target Tissue Specificity
Testis-specific.
Target Synonyms
CFAP44; WDR52Cilia- and flagella-associated protein 44; WD repeat-containing protein 52
Target Background
Enables peptidase activity. Involved in sperm axoneme assembly. Acts upstream of or within microtubule cytoskeleton organization. Predicted to be located in cytoplasm; cytoskeleton; and motile cilium. Implicated in spermatogenic failure 20.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
