-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ORAI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ORAI1 (NP_116179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ORAI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ORAI1 (NP_116179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11769A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ORAI1 |
| Target Synonyms | IMD9; TAM2; ORAT1; CRACM1; TMEM142A; ORAI1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse lung, Mouse spleen, Mouse testis, Rat liver, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ORAI1 (NP_116179.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFA | Uniprot ID | Q96D31 |
Uniprot Id
Q96D31
Target Species
Human
Target Name
ORAI1
Target Full Name
Calcium release-activated calcium channel protein 1
Target Function
Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1. CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT. Plays a prominent role in Ca(2+) influx at the basolateral membrane of mammary epithelial cells independently of the Ca(2+) content of endoplasmic reticulum or Golgi stores. May mediate transepithelial transport of large quantities of Ca(2+) for milk secretion.
Target Involvement
Immunodeficiency 9 (IMD9); Myopathy, tubular aggregate, 2 (TAM2)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
Orai family
Target Tissue Specificity
Expressed in naive CD4 and CD8 T cells (at protein level). Expressed at similar levels in naive and effector T helper cells.
Target Synonyms
ORAI1; CRACM1; TMEM142A; Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A
Target Background
The protein encoded by this gene is a membrane calcium channel subunit that is activated by the calcium sensor STIM1 when calcium stores are depleted. This type of channel is the primary way for calcium influx into T-cells. Defects in this gene are a cause of immune dysfunction with T-cell inactivation due to calcium entry defect type 1 (IDTICED1).
Notification