-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX11 (NP_003099.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SOX11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX11 (NP_003099.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11889A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX11 |
| Target Synonyms | CSS9; MRD27; IDDMOH; SOX11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BT-474, Mouse brain, Neuro-2a, SH-SY5Y, Y79 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX11 (NP_003099.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIR | Uniprot ID | P35716 |
Uniprot Id
P35716
Target Species
Human
Target Name
SOX11
Target Full Name
Transcription factor SOX-11
Target Function
Transcription factor that acts as a transcriptional activator. Binds cooperatively with POU3F2/BRN2 or POU3F1/OCT6 to gene promoters, which enhances transcriptional activation. Acts as a transcriptional activator of TEAD2 by binding to its gene promoter and first intron. Plays a redundant role with SOX4 and SOX12 in cell survival of developing tissues such as the neural tube, branchial arches and somites, thereby contributing to organogenesis.
Target Involvement
Mental retardation, autosomal dominant 27 (MRD27)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed primarily in the brain and heart, with low expression in the kidney, pancreas and muscle.
Target Synonyms
MRD27; SOX11; SOX11_HUMAN; SRY (sex determining region Y) box 11; SRY related HMG box gene 11; SRY-box 11; Transcription factor SOX-11
Target Background
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.
Notification