Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against hnRNP C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 86-190 of human hnRNP C (NP_112604.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against hnRNP C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 86-190 of human hnRNP C (NP_112604.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11981A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | hnRNP C |
| Target Synonyms | C1; C2; HNRNP; HNRPC; SNRPC; hnRNP C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Rat testis, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 86-190 of human hnRNP C (NP_112604.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKG | Uniprot ID | P07910 |
Uniprot Id
P07910
Target Species
Human
Target Name
HNRNPC
Target Full Name
Heterogeneous nuclear ribonucleoproteins C1/C2
Target Function
Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. Interacts with poly-U tracts in the 3'-UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules. Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides. May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shown to alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch', facilitating binding of HNRNPC, leading to regulation of mRNA splicing.
Target Subcellular Location
Nucleus. Note=Component of ribonucleosomes.
Target Protein Families
RRM HNRPC family, RALY subfamily
Target Synonyms
C1; C2; Heterogeneous nuclear ribonucleoprotein C (C1/C2); Heterogeneous nuclear ribonucleoprotein C; Heterogeneous nuclear ribonucleoproteins C1/C2; HNRNP; hnRNP C1 / hnRNP C2; hnRNP C1/C2; Hnrnpc; HNRPC; HNRPC_HUMAN; MGC104306; MGC105117; MGC117353; MGC131677; Nuclear ribonucleoprotein particle C1 protein; Nuclear ribonucleoprotein particle C2 protein; SNRPC
Target Background
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
