-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPE1/HSP10/CPN10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human HSPE1/HSP10/CPN10 (NP_002148.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HSPE1/HSP10/CPN10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human HSPE1/HSP10/CPN10 (NP_002148.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12105A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPE1/HSP10/CPN10 |
| Target Synonyms | EPF; CPN10; GROES; HSP10; HSPE1/HSP10/CPN10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse liver, Rat liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human HSPE1/HSP10/CPN10 (NP_002148.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD | Uniprot ID | P61604 |
Uniprot Id
P61604
Target Species
Human
Target Name
HSPE1
Target Full Name
10 kDa heat shock protein, mitochondrial
Target Function
Co-chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp60, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix. The functional units of these chaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and association with 2 heptameric rings of the co-chaperonin Hsp10. This leads to sequestration of the substrate protein in the inner cavity of Hsp60 where, for a certain period of time, it can fold undisturbed by other cell components. Synchronous hydrolysis of ATP in all Hsp60 subunits results in the dissociation of the chaperonin rings and the release of ADP and the folded substrate protein.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
GroES chaperonin family
Target Research Area
Neuroscience
Target Synonyms
10 kDa chaperonin; 10 kDa heat shock protein mitochondrial; 10 kDa heat shock protein; mitochondrial; CH10_HUMAN; Chaperonin 10; Chaperonin 10 homolog; CPN10; cpn10 homolog; Early pregnancy factor; Early-pregnancy factor; EPF; GROES; GroES homolog; Heat shock 10kD protein 1 chaperonin 10; Heat shock 10kDa protein 1; Heat shock 10kDa protein 1 chaperonin 10; Heat shock protein family E (Hsp10) member; Heat-shock 10-kD protein; Hsp10; Hspe1
Target Background
This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.
Notification