Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against METTL7B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 165-244 of human METTL7B (NP_689850.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against METTL7B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 165-244 of human METTL7B (NP_689850.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12107A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | METTL7B |
| Target Synonyms | ALDI; METTL7B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 165-244 of human METTL7B (NP_689850.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK | Uniprot ID | Q6UX53 |
Uniprot Id
Q6UX53
Target Species
Human
Target Name
METTL7B
Target Full Name
Thiol S-methyltransferase TMT1B
Target Function
Thiol S-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-l-methionine to hydrogen sulfide and other thiol compounds including dithiothreitol, 7alpha-thiospironolactone, L-penicillamine, and captopril.
Target Subcellular Location
Endoplasmic reticulum membrane; Peripheral membrane protein. Lipid droplet.
Target Protein Families
Methyltransferase superfamily
Target Synonyms
MET7B_HUMAN; Methyltransferase like 7B; Methyltransferase like protein 7B; Methyltransferase-like protein 7B; METTL7B; MGC17301; OTTHUMP00000202178
Target Background
Enables thiol S-methyltransferase activity. Predicted to be involved in methylation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
