-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Histone H2AX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human Histone H2AX. (NP_002096.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Histone H2AX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human Histone H2AX. (NP_002096.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12197A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Histone H2AX |
| Target Synonyms | H2A.X; H2A/X; H2AFX; Histone H2AX | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse testis, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human Histone H2AX (NP_002096.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY | Uniprot ID | P16104 |
Uniprot Id
P16104
Target Species
Human
Target Name
H2AX
Target Full Name
Histone H2AX
Target Function
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Histone H2A family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
H2A histone family member X ; H2A histone family member X; H2A.FX; H2A.X; H2a/x; H2AFX; H2AX; H2AX_HUMAN; Histone H2A.X
Target Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.
Notification