-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADAM12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 589-738 of human ADAM12 (NP_067673.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ADAM12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 589-738 of human ADAM12 (NP_067673.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12300A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADAM12 |
| Target Synonyms | MCMP; MLTN; CAR10; MLTNA; MCMPMltna; ADAM12-OT1; ADAM12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse fat, Mouse ovary, Mouse thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 589-738 of human ADAM12 (NP_067673.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASRPVIGTNAVSIETNIPLQQGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRQCQNISVFGVHECAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQAEARQEAAESNRERGQGQEPVGSQEHASTASLTLI | Uniprot ID | O43184 |
Uniprot Id
O43184
Target Species
Human
Target Name
ADAM12
Target Full Name
Disintegrin and metalloproteinase domain-containing protein 12
Target Function
Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.
Target Tissue Specificity
Isoform 1 is expressed in placenta and skeletal, cardiac, and smooth muscle. Isoform 2 seems to be expressed only in placenta or in embryo and fetus. Both forms were expressed in some tumor cells lines. Not detected in brain, lung, liver, kidney or pancre
Target Synonyms
ADAM12; MLTN; UNQ346/PRO545; Disintegrin and metalloproteinase domain-containing protein 12; ADAM 12; Meltrin-alpha
Target Background
This gene encodes a member of a family of proteins that are structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. Expression of this gene has been used as a maternal serum marker for pre-natal development. Alternative splicing results in multiple transcript variants encoding different isoforms. Shorter isoforms are secreted, while longer isoforms are membrane-bound form.
Notification