-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIRT6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-294 of mouse SIRT6 (NP_001156902.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SIRT6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-294 of mouse SIRT6 (NP_001156902.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12313A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIRT6 |
| Target Synonyms | Sir2l6; mSIRT6; 2810449N18Rik; SIRT6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, A-549, BT-474, HL-60, LO2, Mouse spleen, Mouse stomach | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-294 of mouse SIRT6 (NP_001156902.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | NLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS | Uniprot ID | Q8N6T7 |
Uniprot Id
Q8N6T7
Target Species
Human
Target Name
SIRT6
Target Full Name
NAD-dependent protein deacylase sirtuin-6
Target Function
NAD-dependent protein deacetylase involved in various processes including telomere maintenance and gene expression, and consequently has roles in genomic stability, cell senescence and apoptosis. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. May also be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Deacetylation of nucleosomes interferes with RELA binding to target DNA. Acts as a corepressor of the transcription factor Hif1a to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for normal IGF1 serum levels and normal glucose homeostasis. Regulates the production of TNF protein. Has a role in the regulation of life span.
Target Subcellular Location
Nucleus, nucleoplasm. Note=Predominantly nuclear. Associated with telomeric heterochromatin regions.
Target Protein Families
Sirtuin family, Class IV subfamily
Target Synonyms
2810449N18Rik; AI043036; Mono ADP ribosyltransferase sirtuin 6; NAD-dependent protein deacetylase sirtuin-6; Regulatory protein SIR2 homolog 6; Regulatory protein SIR2 homolog; SIR2 like 6; SIR2 like protein 6 ; Sir2 related protein type 6; SIR2-like protein 6; SIR2L6; SIR6_HUMAN; SIRT 6; SIRT6; Sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae) ; Sirtuin 6; Sirtuin type 6; Sirtuin6
Target Background
This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase and histone deacetylase activities, and plays a role in DNA repair, maintenance of telomeric chromatin, inflammation, lipid and glucose metabolism. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification