Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASCL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ASCL4 (NP_982260.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ASCL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ASCL4 (NP_982260.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12362A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASCL4 |
| Target Synonyms | ASH-4; HASH4; bHLHa44; ASCL4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ASCL4 (NP_982260.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFE | Uniprot ID | Q6XD76 |
Uniprot Id
Q6XD76
Target Species
Human
Target Name
ASCL4
Target Full Name
Achaete-scute homolog 4
Target Function
Could be a transcriptional regulator involved in skin development.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in skin. 7-fold higher expression in fetal skin than in adult skin. Weak expression also detected in fetal lung, aorta and brain, and in adult stomach, kidney, ovary and breast.
Target Synonyms
ASCL4; BHLHA44; HASH4Achaete-scute homolog 4; ASH-4; hASH4; Achaete-scute-like protein 4; Class A basic helix-loop-helix protein 44; bHLHa44
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
