Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFA11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFA11 (NP_783313.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFA11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFA11 (NP_783313.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12389A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFA11 |
| Target Synonyms | B14.7; MC1DN14; CI-B14.7; NDUFA11 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFA11 (NP_783313.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLT | Uniprot ID | Q86Y39 |
Uniprot Id
Q86Y39
Target Species
Human
Target Name
NDUFA11
Target Full Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Involvement
Mitochondrial complex I deficiency (MT-C1D)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.
Target Protein Families
Complex I NDUFA11 subunit family
Target Synonyms
NDUFA11; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11; Complex I-B14.7; CI-B14.7; NADH-ubiquinone oxidoreductase subunit B14.7
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
