-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Connexin 43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 233-382 of human Connexin 43 (NP_000156.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Connexin 43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 233-382 of human Connexin 43 (NP_000156.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12798A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Connexin 43 |
| Target Synonyms | HSS; CMDR; CX43; EKVP; GJAL; ODDD; AVSD3; EKVP3; HLHS1; PPKCA; Connexin 43 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 233-382 of human Connexin 43 (NP_000156.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI | Uniprot ID | P17302 |
Uniprot Id
P17302
Target Species
Human
Target Name
GJA1
Target Full Name
Gap junction alpha-1 protein
Target Function
Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract. May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles.
Target Involvement
Oculodentodigital dysplasia (ODDD); Oculodentodigital dysplasia, autosomal recessive (ODDD-AR); Syndactyly 3 (SDTY3); Hypoplastic left heart syndrome 1 (HLHS1); Hallermann-Streiff syndrome (HSS); Atrioventricular septal defect 3 (AVSD3); Craniometaphyseal dysplasia, autosomal recessive (CMDR); Erythrokeratodermia variabilis et progressiva 3 (EKVP3); Palmoplantar keratoderma and congenital alopecia 1 (PPKCA1)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.
Target Protein Families
Connexin family, Alpha-type (group II) subfamily
Target Tissue Specificity
Expressed in the heart and fetal cochlea.
Target Research Area
Signal Transduction
Target Synonyms
GJA1; GJAL; Gap junction alpha-1 protein; Connexin-43; Cx43; Gap junction 43 kDa heart protein
Target Background
This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia, autosomal recessive craniometaphyseal dysplasia and heart malformations.
Notification