-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC40A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-270 of human SLC40A1 (NP_055400.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC40A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-270 of human SLC40A1 (NP_055400.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12842A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC40A1 |
| Target Synonyms | FPN; FPN1; HFE4; MTP1; IREG1; MST079; MSTP079; SLC11A3; SLC40A1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HEL, MCF7 negative | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-270 of human SLC40A1 (NP_055400.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKD | Uniprot ID | Q9NP59 |
Uniprot Id
Q9NP59
Target Species
Human
Target Name
SLC40A1
Target Full Name
Ferroportin
Target Function
Major iron transporter that plays a key role in balancing cellular and systemic iron levels. Transports iron from intestinal, splenic, and hepatic cells into the blood to provide iron to other tissues. Controls therefore dietary iron uptake, iron recycling by macrophages, and release of iron stores in hepatocytes. When iron is in excess, hepcidin/HAMP levels increase resulting in a degradation of ferroportin/SLC40A1 limiting the iron efflux to plasma.
Target Involvement
Hemochromatosis 4 (HFE4)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Localized to the basolateral membrane of polarized epithelial cells.
Target Protein Families
Ferroportin (FP) (TC 2.A.100) family, SLC40A subfamily
Target Tissue Specificity
Detected in erythrocytes (at protein level). Expressed in placenta, intestine, muscle and spleen.
Target Synonyms
Ferroportin 1; Ferroportin; Ferroportin-1; FPN1; HFE4; IREG1; iron regulated gene 1; Iron regulated transporter 1 ; Iron-regulated transporter 1; MST079; MSTP079; MTP1; putative ferroportin 1 variant IIIA; putative ferroportin 1 variant IIIB; S40A1_HUMAN; SLC11A3; SLC11A3; formerly; SLC40A1; solute carrier family 11 (proton-coupled divalent metal ion transporters); member 3; solute carrier family 11 (proton-coupled divalent metal ion transporters); member 3; formerly; solute carrier family 40 (iron-regulated transporter); member 1; Solute carrier family 40 member 1
Target Background
The protein encoded by this gene is a cell membrane protein that may be involved in iron export from duodenal epithelial cells. Defects in this gene are a cause of hemochromatosis type 4 (HFE4).
Notification