-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ku80 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 543-732 of human Ku80 (NP_066964.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against Ku80 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 543-732 of human Ku80 (NP_066964.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-12851A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ku80 |
| Target Synonyms | KU80; KUB2; Ku86; NFIV; KARP1; KARP-1; Ku80 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, MCF7 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 543-732 of human Ku80 (NP_066964.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI | Uniprot ID | P13010 |
Uniprot Id
P13010
Target Species
Human
Target Name
XRCC5
Target Full Name
X-ray repair cross-complementing protein 5
Target Function
Single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA non-homologous end joining (NHEJ) by recruiting DNA-PK to DNA. Required for double-strand break repair and V(D)J recombination. Also has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. During NHEJ, the XRCC5-XRRC6 dimer performs the recognition step: it recognizes and binds to the broken ends of the DNA and protects them from further resection. Binding to DNA may be mediated by XRCC6. The XRCC5-XRRC6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5-XRRC6 dimer is probably involved in stabilizing broken DNA ends and bringing them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. The XRCC5-XRRC6 dimer probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. XRCC5 probably acts as the catalytic subunit of 5'-dRP activity, and allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5-XRRC6 dimer together with APEX1 acts as a negative regulator of transcription. In association with NAA15, the XRCC5-XRRC6 dimer binds to the osteocalcin promoter and activates osteocalcin expression. As part of the DNA-PK complex, involved in the early steps of ribosome assembly by promoting the processing of precursor rRNA into mature 18S rRNA in the small-subunit processome. Binding to U3 small nucleolar RNA, recruits PRKDC and XRCC5/Ku86 to the small-subunit processome. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Chromosome.
Target Protein Families
Ku80 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
86 kDa subunit of Ku antigen; ATP dependent DNA helicase 2 subunit 2; ATP dependent DNA helicase II 80 kDa subunit; ATP dependent DNA helicase II 86 Kd subunit; ATP dependent DNA helicase II; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; CTC box binding factor 85 kDa; CTC box-binding factor 85 kDa subunit; CTC85; CTCBF; DNA repair protein XRCC5; KARP 1; KARP1; Ku 80; Ku autoantigen 80kDa; Ku80; Ku86; Ku86 autoantigen related protein 1; KUB 2; KUB2; Lupus Ku autoantigen protein p86; NFIV; Nuclear factor IV; Thyroid lupus autoantigen; Thyroid-lupus autoantigen; TLAA; X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining); X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X-ray repair cross-complementing protein 5; Xray repair complementing defective repair in Chinese hamster cells 5; XRCC 5; XRCC5; XRCC5_HUMAN
Target Background
The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
Notification