-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SETD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2475-2564 of human SETD2 (NP_054878.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against SETD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2475-2564 of human SETD2 (NP_054878.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-12958A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SETD2 |
| Target Synonyms | LLS; HYPB; SET2; HIF-1; HIP-1; KMT3A; MRD70; RAPAS; HBP231; HSPC069; p231HBP; SETD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2475-2564 of human SETD2 (NP_054878.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE | Uniprot ID | Q9BYW2 |
Uniprot Id
Q9BYW2
Target Species
Human
Target Name
SETD2
Target Full Name
Histone-lysine N-methyltransferase SETD2
Target Function
Histone methyltransferase that specifically trimethylates 'Lys-36' of histone H3 (H3K36me3) using dimethylated 'Lys-36' (H3K36me2) as substrate. It is capable of trimethylating unmethylated H3K36 (H3K36me0) in vitro. Represents the main enzyme generating H3K36me3, a specific tag for epigenetic transcriptional activation. Plays a role in chromatin structure modulation during elongation by coordinating recruitment of the FACT complex and by interacting with hyperphosphorylated POLR2A. Acts as a key regulator of DNA mismatch repair in G1 and early S phase by generating H3K36me3, a mark required to recruit MSH6 subunit of the MutS alpha complex: early recruitment of the MutS alpha complex to chromatin to be replicated allows a quick identification of mismatch DNA to initiate the mismatch repair reaction. Required for DNA double-strand break repair in response to DNA damage: acts by mediating formation of H3K36me3, promoting recruitment of RAD51 and DNA repair via homologous recombination (HR). Acts as a tumor suppressor. H3K36me3 also plays an essential role in the maintenance of a heterochromatic state, by recruiting DNA methyltransferase DNMT3A. H3K36me3 is also enhanced in intron-containing genes, suggesting that SETD2 recruitment is enhanced by splicing and that splicing is coupled to recruitment of elongating RNA polymerase. Required during angiogenesis. Required for endoderm development by promoting embryonic stem cell differentiation toward endoderm: acts by mediating formation of H3K36me3 in distal promoter regions of FGFR3, leading to regulate transcription initiation of FGFR3. In addition to histones, also mediates methylation of other proteins, such as tubulins and STAT1. Trimethylates 'Lys-40' of alpha-tubulins such as TUBA1B (alpha-TubK40me3); alpha-TubK40me3 is required for normal mitosis and cytokinesis and may be a specific tag in cytoskeletal remodeling. Involved in interferon-alpha-induced antiviral defense by mediating both monomethylation of STAT1 at 'Lys-525' and catalyzing H3K36me3 on promoters of some interferon-stimulated genes (ISGs) to activate gene transcription.; (Microbial infection) Recruited to the promoters of adenovirus 12 E1A gene in case of infection, possibly leading to regulate its expression.
Target Involvement
Renal cell carcinoma (RCC); Luscan-Lumish syndrome (LLS); Leukemia, acute lymphoblastic (ALL); Leukemia, acute myelogenous (AML)
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, SET2 subfamily
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
EC 2.1.1.43; FLJ16420; FLJ22472; FLJ23184; FLJ45883 ; HBP231; HIF 1; HIF-1; HIF1; HIP-1; Histone lysine N methyltransferase SETD2; Histone-lysine N-methyltransferase SETD2; hSET2; HSPC069; Huntingtin interacting protein 1; Huntingtin interacting protein; Huntingtin interacting protein B; Huntingtin interacting protein HYPB; Huntingtin yeast partner B; Huntingtin-binding protein; 231-KD; Huntingtin-interacting protein 1; Huntingtin-interacting protein B; HYPB; KIAA1732; KMT3A; Lysine N methyltransferase 3A; Lysine N-methyltransferase 3A; p231HBP; SET domain containing 2; SET domain-containing protein 2; SET2; SETD2; SETD2_HUMAN
Target Background
Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs. This protein is a histone methyltransferase that is specific for lysine-36 of histone H3, and methylation of this residue is associated with active chromatin. This protein also contains a novel transcriptional activation domain and has been found associated with hyperphosphorylated RNA polymerase II.
Notification