-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1600 to the C-terminus of human CHD1 (NP_001261.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CHD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1600 to the C-terminus of human CHD1 (NP_001261.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13157A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHD1 |
| Target Synonyms | CHD-1; PILBOS; D1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1600 to the C-terminus of human CHD1 (NP_001261.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DREKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKSTPEHTWSSRKT | Uniprot ID | O14646 |
Uniprot Id
O14646
Target Species
Human
Target Name
CHD1
Target Full Name
Chromodomain-helicase-DNA-binding protein 1
Target Function
ATP-dependent chromatin-remodeling factor which functions as substrate recognition component of the transcription regulatory histone acetylation (HAT) complex SAGA. Regulates polymerase II transcription. Also required for efficient transcription by RNA polymerase I, and more specifically the polymerase I transcription termination step. Regulates negatively DNA replication. Not only involved in transcription-related chromatin-remodeling, but also required to maintain a specific chromatin configuration across the genome. Is also associated with histone deacetylase (HDAC) activity. Required for the bridging of SNF2, the FACT complex, the PAF complex as well as the U2 snRNP complex to H3K4me3. Functions to modulate the efficiency of pre-mRNA splicing in part through physical bridging of spliceosomal components to H3K4me3. Required for maintaining open chromatin and pluripotency in embryonic stem cells.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
SNF2/RAD54 helicase family
Target Tissue Specificity
Expressed in many tissues including in the brain, where the highest level of expression is found in the cerebellum and basal ganglia.
Target Synonyms
ATP dependent helicase CHD 1; ATP-dependent helicase CHD1; CHD 1; CHD-1; Chd1; CHD1_HUMAN; Chromodomain helicase DNA binding protein 1; Chromodomain-helicase-DNA-binding protein 1; DKFZp686E2337; OTTHUMP00000222625
Target Background
The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template.
Notification