Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MDH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MDH2 (P40926) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MDH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MDH2 (P40926) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13182A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MDH2 |
| Target Synonyms | MDH; MOR1; DEE51; M-MDH; EIEE51; MGC:3559; MDH2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, A-431, Mouse small intestine, Rat kidney, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MDH2 (P40926). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPI | Uniprot ID | P40926 |
Uniprot Id
P40926
Target Species
Human
Target Name
MDH2
Target Full Name
Malate dehydrogenase, mitochondrial
Target Involvement
Epileptic encephalopathy, early infantile, 51 (EIEE51)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
LDH/MDH superfamily, MDH type 1 family
Target Research Area
Signal Transduction
Target Synonyms
M MDH; Malate dehydrogenase 2; NAD (mitochondrial); Malate dehydrogenase; Malate dehydrogenase; mitochondrial; MDH; mdh2; MDHM_HUMAN; MGC:3559; mitochondrial; Mitochondrial malate dehydrogenase 2; NAD; Mor 1; MOR1
Target Background
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Several transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
