-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNTN4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human CNTN4 (Q8IWV2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CNTN4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human CNTN4 (Q8IWV2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13215A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNTN4 |
| Target Synonyms | AXCAM; BIG-2; CNTN4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HT-29 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human CNTN4 (Q8IWV2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPP | Uniprot ID | Q8IWV2 |
Uniprot Id
Q8IWV2
Target Species
Human
Target Name
CNTN4
Target Full Name
Contactin-4
Target Function
Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity. May be involved in synaptogenesis.
Target Involvement
A chromosomal aberration involving CNTN4 has been found in a boy with characteristic physical features of 3p deletion syndrome (3PDS). Translocation t(3;10)(p26;q26). 3PDS is a rare contiguous gene disorder involving the loss of the telomeric portion of the short arm of chromosome 3 and characterized by developmental delay, growth retardation, and dysmorphic features.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted.
Target Protein Families
Immunoglobulin superfamily, Contactin family
Target Tissue Specificity
Mainly expressed in brain. Highly expressed in cerebellum and weakly expressed in corpus callosum, caudate nucleus, amygdala and spinal cord. Also expressed in testis, pancreas, thyroid, uterus, small intestine and kidney. Not expressed in skeletal muscle
Target Synonyms
AXCAM; Axonal associated cell adhesion molecule; BIG 2; BIG-2; Brain derived immunoglobulin superfamily protein 2; Brain-derived immunoglobulin superfamily protein 2; Cntn4; CNTN4_HUMAN; CNTN4A; contactin 4; Contactin-4; Neural cell adhesion protein BIG 2; SCA16
Target Background
This gene encodes a member of the contactin family of immunoglobulins. Contactins are axon-associated cell adhesion molecules that function in neuronal network formation and plasticity. The encoded protein is a glycosylphosphatidylinositol-anchored neuronal membrane protein that may play a role in the formation of axon connections in the developing nervous system. Deletion or mutation of this gene may play a role in 3p deletion syndrome and autism spectrum disorders. Alternative splicing results in multiple transcript variants.
Notification