-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIF4A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF4A (O95239) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against KIF4A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF4A (O95239) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13234A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIF4A |
| Target Synonyms | KIF4; KIF4G1; MRX100; XLID100; KIF4A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF4A (O95239). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGG | Uniprot ID | O95239 |
Uniprot Id
O95239
Target Species
Human
Target Name
KIF4A
Target Full Name
Chromosome-associated kinesin KIF4A
Target Function
Iron-sulfur (Fe-S) cluster binding motor protein that has a role in chromosome segregation during mitosis. Translocates PRC1 to the plus ends of interdigitating spindle microtubules during the metaphase to anaphase transition, an essential step for the formation of an organized central spindle midzone and midbody and for successful cytokinesis. May play a role in mitotic chromosomal positioning and bipolar spindle stabilization.
Target Subcellular Location
Nucleus matrix. Cytoplasm. Cytoplasm, cytoskeleton, spindle. Midbody. Chromosome.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, Chromokinesin subfamily
Target Tissue Specificity
Highly expressed in hematopoietic tissues, fetal liver, spleen, thymus and adult thymus and bone marrow. Lower levels are found in heart, testis, kidney, colon and lung.
Target Synonyms
Chromokinesin; Chromokinesin-A; Chromosome associated kinesin KIF4A; Chromosome-associated kinesin KIF4A; FLJ12530; FLJ12655; FLJ14204; FLJ20631; HSA271784; KIF4; KIF4 G1; KIF4A; KIF4A_HUMAN; KIF4G1; Kinesin family member 4A
Target Background
This gene encodes a member of the kinesin 4 subfamily of kinesin related proteins. The encoded protein is an ATP dependent microtubule-based motor protein that is involved in the intracellular transport of membranous organelles. This protein also associates with condensed chromosome arms and may be involved in maintaining chromosome integrity during mitosis. This protein may also be involved in the organization of the central spindle prior to cytokinesis. A pseudogene of this gene is found on chromosome X.
Notification