-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMC5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PSMC5 (NP_002796.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PSMC5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PSMC5 (NP_002796.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13276A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMC5 |
| Target Synonyms | S8; p45; RPT6; SUG1; SUG-1; TBP10; TRIP1; p45/SUG; PSMC5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, MCF7, Molt-4, Mouse brain, Mouse liver, Rat testis, SKOV3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PSMC5 (NP_002796.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVD | Uniprot ID | P62195 |
Uniprot Id
P62195
Target Species
Human
Target Name
PSMC5
Target Full Name
26S proteasome regulatory subunit 8
Target Function
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. PSMC5 belongs to the heterohexameric ring of AAA (ATPases associated with diverse cellular activities) proteins that unfolds ubiquitinated target proteins that are concurrently translocated into a proteolytic chamber and degraded into peptides.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
AAA ATPase family
Target Synonyms
26S protease regulatory subunit 8; 26S proteasome AAA-ATPase subunit RPT6; Cim3; MSUG1 protein; p45; p45/SUG; Proteasome 26S ATPase subunit 5; Proteasome 26S subunit ATPase 5; Proteasome prosome macropain 26S subunit ATPase 5; Proteasome subunit p45; PRS8_HUMAN; PSMC5; Rpt6; S8; SUG1; Tat binding protein homolog 10 ; TBP10; Thyroid hormone receptor interacting protein 1; Thyroid hormone receptor-interacting protein 1; Thyroid receptor interactor 1; TRIP1; TRIP1(SUG1)
Target Background
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha. Two transcript variants encoding different isoforms have been found for this gene.
Notification