-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRMT7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT7 (Q9NVM4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRMT7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT7 (Q9NVM4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13297A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRMT7 |
| Target Synonyms | SBIDDS; PRMT7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat brain, MCF7, Mouse brain, Mouse testis, Rat testis, SW620 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT7 (Q9NVM4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQGIRAAVSRVKDRGQKALVLDIGTGTGLLSMMAVTAGADFCYAIEVFKPMA | Uniprot ID | Q9NVM4 |
Uniprot Id
Q9NVM4
Target Species
Human
Target Name
PRMT7
Target Full Name
Protein arginine N-methyltransferase 7
Target Function
Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Specifically mediates the symmetric dimethylation of histone H4 'Arg-3' to form H4R3me2s. Plays a role in gene imprinting by being recruited by CTCFL at the H19 imprinted control region (ICR) and methylating histone H4 to form H4R3me2s, possibly leading to recruit DNA methyltransferases at these sites. May also play a role in embryonic stem cell (ESC) pluripotency. Also able to mediate the arginine methylation of histone H2A and myelin basic protein (MBP) in vitro; the relevance of such results is however unclear in vivo.
Target Involvement
Short stature, brachydactyly, intellectual developmental disability, and seizures (SBIDDS)
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, Protein arginine N-methyltransferase family, PRMT7 subfamily
Target Synonyms
[Myelin basic protein]-arginine N-methyltransferase PRMT7; ANM7_HUMAN; FLJ10640; Histone-arginine N-methyltransferase PRMT7; KIAA1933; Myelin basic protein arginine N methyltransferase; OTTHUMP00000174863; PRMT7; Protein arginine methyltransferase 7; Protein arginine N-methyltransferase 7
Target Background
This gene encodes a member of the protein arginine N-methyltransferase family of proteins. The encoded enzyme transfers single methyl groups to arginine residues to generate monomethylarginines on histone proteins as well as other protein substrates. This enzyme plays a role in a wide range of biological processes, including neuronal differentiation, male germ line imprinting, small nuclear ribonucleoprotein biogenesis, and regulation of the Wnt signaling pathway. Mutations in this gene underlie multiple related syndromes in human patients characterized by intellectual disability, short stature and other features. The encoded protein may promote breast cancer cell invasion and metastasis in human patients.
Notification