-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TEMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human TEMT (O95050) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TEMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human TEMT (O95050) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13338A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TEMT |
| Target Synonyms | TEMT | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human TEMT (O95050). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLA | Uniprot ID | O95050 |
Uniprot Id
O95050
Target Species
Human
Target Name
INMT
Target Full Name
Indolethylamine N-methyltransferase
Target Function
Functions as thioether S-methyltransferase and is active with a variety of thioethers and the corresponding selenium and tellurium compounds, including 3-methylthiopropionaldehyde, dimethyl selenide, dimethyl telluride, 2-methylthioethylamine, 2-methylthioethanol, methyl-n-propyl sulfide and diethyl sulfide. Plays an important role in the detoxification of selenium compounds. Catalyzes the N-methylation of tryptamine and structurally related compounds.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, NNMT/PNMT/TEMT family
Target Tissue Specificity
Widely expressed. The highest levels were in thyroid, adrenal gland, adult and fetal lung. Intermediate levels in heart, placenta, skeletal muscle, testis, small intestine, pancreas, stomach, spinal cord, lymph node and trachea. Very low levels in adult a
Target Research Area
Metabolism
Target Synonyms
Amine N methyltransferase; Amine N-methyltransferase; Aromatic alkylamine N methyltransferase; Aromatic alkylamine N-methyltransferase; Arylamine N methyltransferase; Arylamine N-methyltransferase; Indolamine N-methyltransferase; Indolethylamine N methyltransferase; Indolethylamine N-methyltransferase; Inmt; INMT_HUMAN; nicotine N methyltransferase ; TEMT; thioester S methyltransferase like; Thioether S methyltransferase
Target Background
N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream MINDY4 (aka FAM188B) gene. In rodents and other mammals such as cetartiodactyla this gene is in the opposite orientation compared to its orientation in human and other primates and this gene appears to have been lost in carnivora and chiroptera.
Notification