Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DTYMK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human DTYMK (P23919) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DTYMK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human DTYMK (P23919) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13366A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DTYMK |
| Target Synonyms | CDC8; TMPK; TYMK; CONPM; PP3731; DTYMK | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DTYMK (P23919). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIR | Uniprot ID | P23919 |
Uniprot Id
P23919
Target Species
Human
Target Name
DTYMK
Target Full Name
Thymidylate kinase
Target Function
Catalyzes the conversion of dTMP to dTDP.
Target Protein Families
Thymidylate kinase family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CDC8; Deoxythymidylate kinase (thymidylate kinase); deoxythymidylate kinase; dTMP kinase; Dtymk; FLJ44192; KTHY_HUMAN; MGC198617; OTTHUMP00000164604; OTTHUMP00000200145; OTTHUMP00000200146; PP3731; Thymidylate kinase; TMPK; TYMK
Target Background
Enables thymidylate kinase activity. Predicted to be involved in dTDP biosynthetic process; dTTP biosynthetic process; and dUDP biosynthetic process. Predicted to act upstream of or within cellular response to growth factor stimulus and nucleotide biosynthetic process. Predicted to be located in mitochondrial intermembrane space and mitochondrial matrix. Predicted to be active in cytosol; mitochondrion; and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
